LCE2A_HUMAN Q5TA79
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5TA79
Recommended name：Late cornified envelope protein 2A
EC number：
Alternative names：(Late envelope protein 9)
Cleaved into：
GeneID：353139
Gene names (primary )：LCE2A
Gene names (synonym )：LEP9
Gene names (ORF )：
Length：106
Mass：10846
Sequence：MSCQQNQQQCQPPPKCPPKCPPKCPPKCRPQCPAPCPPPVSSCCGPSSGGCCGSSSGGCCSSGGGGCCLSHHRPRLFHRHRHQSPDCCECEPSGGSGCCHSSGDCC
Tissue specificity：Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049}.
Induction：By calcium and UVB. {ECO:0000269|PubMed:15854049}.
Developmental stage：
Protein families：LCE family