LCE2D_HUMAN Q5TA82
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5TA82
Recommended name：Late cornified envelope protein 2D
EC number：
Alternative names：(Late envelope protein 12) (Small proline-rich-like epidermal differentiation complex protein 1A)
Cleaved into：
GeneID：353141
Gene names (primary )：LCE2D
Gene names (synonym )：LEP12 SPRL1A
Gene names (ORF )：
Length：110
Mass：11180
Sequence：MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCCSSGGGGCCLSHHRPRLFHRRRHQSPDCCESEPSGASGCCHSSGGCC
Tissue specificity：Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049}.
Induction：By calcium and UVB. {ECO:0000269|PubMed:15854049}.
Developmental stage：
Protein families：LCE family