GDNF_HUMAN P39905
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P39905
Recommended name:Glial cell line-derived neurotrophic factor
EC number:
Alternative names:(hGDNF) (Astrocyte-derived trophic factor) (ATF)
Cleaved into:
GeneID:2668
Gene names (primary ):GDNF
Gene names (synonym ):
Gene names (ORF ):
Length:211
Mass:23720
Sequence:MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Tissue specificity:In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. Highest expression of isoform 3 is found in pancreatic islets. Isoform 5 is expressed at very low levels in putamen, nucleus accumbens, prefrontal cortex, amygdala, hypothalamus and intestine. Isoform 3 is up-regulated in the middle temporal gyrus of Alzheimer disease patients while isoform 2 shows no change. {ECO:0000269|PubMed:22081608, ECO:0000269|PubMed:7867768}.
Induction:By cAMP, 12-O-tetradecanoylphorbol-13-acetate (TPA) and FGF2. {ECO:0000269|PubMed:9811930}.
Developmental stage:
Protein families:TGF-beta family, GDNF subfamily