CIRBP_HUMAN Q14011
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14011
Recommended name：Cold-inducible RNA-binding protein
EC number：
Alternative names：(A18 hnRNP) (Glycine-rich RNA-binding protein CIRP)
Cleaved into：
GeneID：1153
Gene names (primary )：CIRBP
Gene names (synonym )：A18HNRNP CIRP
Gene names (ORF )：
Length：172
Mass：18648
Sequence：MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Tissue specificity：Ubiquitous.
Induction：By cold stress in response to DNA damage induced by UV irradiation or UV mimetic agents. Up-regulated by hypoxia. {ECO:0000269|PubMed:15075239}.
Developmental stage：
Protein families：