RHOH_HUMAN Q15669
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15669
Recommended name：Rho-related GTP-binding protein RhoH
EC number：
Alternative names：(GTP-binding protein TTF) (Translocation three four protein)
Cleaved into：
GeneID：399
Gene names (primary )：RHOH
Gene names (synonym )：ARHH TTF
Gene names (ORF )：
Length：191
Mass：21331
Sequence：MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF
Tissue specificity：Expressed only in hematopoietic cells. Present at very high levels in the thymus, less abundant in the spleen, and least abundant in the bone marrow. Expressed at a higher level in the TH1 subtype of T-helper cells than in the TH2 subpopulation. Expressed in neutrophils under inflammatory conditions, such as cystic fibrosis, ulcerative colitis and appendicitis. {ECO:0000269|PubMed:11809807, ECO:0000269|PubMed:19414807}.
Induction：By CSF2/GM-CSF. Down-regulated by phorbol myristate acetate (PMA). {ECO:0000269|PubMed:11809807, ECO:0000269|PubMed:19414807}.
Developmental stage：
Protein families：Small GTPase superfamily, Rho family