RASD1_HUMAN Q9Y272
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y272
Recommended name：Dexamethasone-induced Ras-related protein 1
EC number：
Alternative names：(Activator of G-protein signaling 1)
Cleaved into：
GeneID：51655
Gene names (primary )：RASD1
Gene names (synonym )：AGS1 DEXRAS1
Gene names (ORF )：
Length：281
Mass：31642
Sequence：MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS
Tissue specificity：Expressed in a variety of tissues including heart, cardiovascular tissues, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, gastrointestinal and reproductive tissues. {ECO:0000269|PubMed:10673050, ECO:0000269|PubMed:12818426}.
Induction：By dexamethasone. {ECO:0000269|PubMed:10673050}.
Developmental stage：
Protein families：Small GTPase superfamily, RasD family