PLPP3_HUMAN O14495
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14495
Recommended name：Phospholipid phosphatase 3
EC number：EC:3.1.3.-
Alternative names：(Lipid phosphate phosphohydrolase 3) (PAP2-beta) (Phosphatidate phosphohydrolase type 2b) (Phosphatidic acid phosphatase 2b) (PAP-2b) (PAP2b) (Vascular endothelial growth factor and type I collagen-inducible protein) (VCIP)
Cleaved into：
GeneID：8613
Gene names (primary )：PLPP3
Gene names (synonym )：LPP3 PPAP2B
Gene names (ORF )：
Length：311
Mass：35116
Sequence：MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM
Tissue specificity：Ubiquitously expressed (PubMed:9305923, PubMed:12660161). Highly expressed in heart and placenta (PubMed:9305923). {ECO:0000269|PubMed:12660161, ECO:0000269|PubMed:9305923}.
Induction：By EGF, VEGF, FGF2 and phorbol myristate acetate (PMA). {ECO:0000269|PubMed:9305923}.
Developmental stage：
Protein families：PA-phosphatase related phosphoesterase family