IL27B_HUMAN   Q14213


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14213

Recommended name:Interleukin-27 subunit beta

EC number:

Alternative names:(IL-27 subunit beta) (IL-27B) (Epstein-Barr virus-induced gene 3 protein) (EBV-induced gene 3 protein)

Cleaved into:

GeneID:10148

Gene names  (primary ):EBI3

Gene names  (synonym ):IL27B

Gene names  (ORF ):

Length:229

Mass:25396

Sequence:MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Tissue specificity:

Induction:By Epstein-Barr virus (EBV). {ECO:0000269|PubMed:8551575}.

Developmental stage:

Protein families:Type I cytokine receptor family, Type 3 subfamily


   💬 WhatsApp