RGCC_HUMAN Q9H4X1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H4X1
Recommended name:Regulator of cell cycle RGCC
EC number:
Alternative names:(Response gene to complement 32 protein) (RGC-32)
Cleaved into:
GeneID:28984
Gene names (primary ):RGCC
Gene names (synonym ):C13orf15 RGC32
Gene names (ORF ):
Length:137
Mass:14559
Sequence:MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Tissue specificity:Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon, breast, prostate, bladder, lung, and ovarian cancer tissues. {ECO:0000269|PubMed:11687586, ECO:0000269|PubMed:15713436}.
Induction:By Epstein-Barr virus (EBV). Up-regulated in aorta endothelial cells in response to complement activation. {ECO:0000269|PubMed:11687586, ECO:0000269|PubMed:22163048}.
Developmental stage:
Protein families: