COX7R_HUMAN O14548
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14548
Recommended name：Cytochrome c oxidase subunit 7A-related protein, mitochondrial
EC number：
Alternative names：(COX7a-related protein) (Cytochrome c oxidase subunit VIIa-related protein) (EB1)
Cleaved into：
GeneID：9167
Gene names (primary )：COX7A2L
Gene names (synonym )：COX7AR COX7RP
Gene names (ORF )：
Length：114
Mass：12615
Sequence：MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Tissue specificity：
Induction：By estrogen.
Developmental stage：
Protein families：Cytochrome c oxidase VIIa family