KLK7_HUMAN P49862
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49862
Recommended name：Kallikrein-7
EC number：EC:3.4.21.117
Alternative names：(hK7) (Serine protease 6) (Stratum corneum chymotryptic enzyme) (hSCCE)
Cleaved into：
GeneID：5650
Gene names (primary )：KLK7
Gene names (synonym )：PRSS6 SCCE
Gene names (ORF )：
Length：253
Mass：27525
Sequence：MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Tissue specificity：Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up-regulated in ovarian carcinoma, especially late-stage serous carcinoma, compared with normal ovaries and benign adenomas (at protein level). {ECO:0000269|PubMed:10974542, ECO:0000269|PubMed:12738725}.
Induction：By estrogens and glucocorticoids in a breast carcinoma cell line. {ECO:0000269|PubMed:10974542}.
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily