FA32A_HUMAN Q9Y421
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y421
Recommended name：Protein FAM32A
EC number：
Alternative names：(Ovarian tumor-associated gene 12) (OTAG-12)
Cleaved into：
GeneID：26017
Gene names (primary )：FAM32A
Gene names (synonym )：OTAG12
Gene names (ORF )：CGI-144
Length：112
Mass：13178
Sequence：MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
Tissue specificity：Expressed in ovary, with isoform 1 being predominant. {ECO:0000269|PubMed:21339736}.
Induction：By etoposide, puromycin or carboplatin. {ECO:0000269|PubMed:21339736}.
Developmental stage：
Protein families：FAM32 family