TNR12_HUMAN Q9NP84
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NP84
Recommended name：Tumor necrosis factor receptor superfamily member 12A
EC number：
Alternative names：(Fibroblast growth factor-inducible immediate-early response protein 14) (FGF-inducible 14) (Tweak-receptor) (TweakR) (CD antigen CD266)
Cleaved into：
GeneID：51330
Gene names (primary )：TNFRSF12A
Gene names (synonym )：FN14
Gene names (ORF )：
Length：129
Mass：13911
Sequence：MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Tissue specificity：Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
Induction：By FGF1 and phorbol ester.
Developmental stage：
Protein families：