AHSP_HUMAN Q9NZD4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NZD4
Recommended name：Alpha-hemoglobin-stabilizing protein
EC number：
Alternative names：(Erythroid differentiation-related factor) (Erythroid-associated factor)
Cleaved into：
GeneID：51327
Gene names (primary )：AHSP
Gene names (synonym )：EDRF ERAF
Gene names (ORF )：
Length：102
Mass：11840
Sequence：MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Tissue specificity：Expressed in blood and bone marrow. {ECO:0000269|PubMed:11231637, ECO:0000269|PubMed:12066189}.
Induction：By GATA1 during erythroid maturation.
Developmental stage：
Protein families：AHSP family