KAD4_HUMAN P27144
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27144
Recommended name：Adenylate kinase 4, mitochondrial
EC number：EC:2.7.4.10
Alternative names：(AK 4) (Adenylate kinase 3-like) (GTP:AMP phosphotransferase AK4)
Cleaved into：
GeneID：205
Gene names (primary )：AK4
Gene names (synonym )：AK3 AK3L1
Gene names (ORF )：
Length：223
Mass：25268
Sequence：MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Tissue specificity：Highly expressed in kidney, moderately expressed in heart and liver and weakly expressed in brain. {ECO:0000269|PubMed:11485571}.
Induction：By hypoxia (at protein level). {ECO:0000269|PubMed:19130895, ECO:0000269|PubMed:23474458, ECO:0000269|PubMed:26980435}.
Developmental stage：
Protein families：Adenylate kinase family, AK3 subfamily