LUZP6_HUMAN Q538Z0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q538Z0
Recommended name：Leucine zipper protein 6
EC number：
Alternative names：(Myeloproliferative disease-associated 6 kDa antigen)
Cleaved into：
GeneID：767558
Gene names (primary )：LUZP6
Gene names (synonym )：MPD6
Gene names (ORF )：
Length：58
Mass：6437
Sequence：MKSVISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSSPF
Tissue specificity：Widely expressed, highest levels found in brain, placenta, spleen, testis, and ovary. Up-regulated in some tumor cells. {ECO:0000269|PubMed:16982933}.
Induction：By IFNA1. {ECO:0000269|PubMed:16982933}.
Developmental stage：
Protein families：