IFM3_HUMAN   Q01628


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q01628

Recommended name:Interferon-induced transmembrane protein 3

EC number:

Alternative names:(Dispanin subfamily A member 2b) (DSPA2b) (Interferon-inducible protein 1-8U)

Cleaved into:

GeneID:10410

Gene names  (primary ):IFITM3

Gene names  (synonym ):

Gene names  (ORF ):

Length:133

Mass:14632

Sequence:MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

Tissue specificity:

Induction:By IFN-alpha and IFNG/IFN-gamma.

Developmental stage:

Protein families:CD225/Dispanin family


   💬 WhatsApp