IFM1_HUMAN   P13164


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P13164

Recommended name:Interferon-induced transmembrane protein 1

EC number:

Alternative names:(Dispanin subfamily A member 2a) (DSPA2a) (Interferon-induced protein 17) (Interferon-inducible protein 9-27) (Leu-13 antigen) (CD antigen CD225)

Cleaved into:

GeneID:8519

Gene names  (primary ):IFITM1

Gene names  (synonym ):CD225 IFI17

Gene names  (ORF ):

Length:125

Mass:13964

Sequence:MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Tissue specificity:Bone (at protein level). Levels greatly elevated in colon cancer, cervical cancer, esophageal cancer and ovarian cancer. Expressed in glioma cell lines. {ECO:0000269|PubMed:20838853, ECO:0000269|PubMed:22634173}.

Induction:By IFN-alpha and IFNG/IFN-gamma.

Developmental stage:

Protein families:CD225/Dispanin family


   💬 WhatsApp