PLAT3_HUMAN P53816
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P53816
Recommended name:Phospholipase A and acyltransferase 3
EC number:EC:2.3.1.-
Alternative names:(Adipose-specific phospholipase A2) (AdPLA) (Group XVI phospholipase A1/A2) (H-rev 107 protein homolog) (H-REV107) (HREV107-1) (HRAS-like suppressor 1) (HRAS-like suppressor 3) (HRSL3) (HREV107-3) (Renal carcinoma antigen NY-REN-65)
Cleaved into:
GeneID:11145
Gene names (primary ):PLAAT3
Gene names (synonym ):HRASLS3 HREV107 PLA2G16
Gene names (ORF ):
Length:162
Mass:17937
Sequence:MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
Tissue specificity:Widely expressed. low expression, if any, in hematopoietic cells and thymus. In testis, confined to round spermatids. Expressed in normal ovarian epithelial cells. Down-regulated in some ovarian carcinomas and testicular germ cell tumors. Highly expressed in white adipose tissue (PubMed:19136964). {ECO:0000269|PubMed:11526504, ECO:0000269|PubMed:11973642, ECO:0000269|PubMed:19136964, ECO:0000269|PubMed:19615464, ECO:0000269|PubMed:9771974}.
Induction:By IFNG and IRF1. {ECO:0000269|PubMed:11973642}.
Developmental stage:
Protein families:H-rev107 family