CXL11_HUMAN O14625
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14625
Recommended name：C-X-C motif chemokine 11
EC number：
Alternative names：(Beta-R1) (H174) (Interferon gamma-inducible protein 9) (IP-9) (Interferon-inducible T-cell alpha chemoattractant) (I-TAC) (Small-inducible cytokine B11)
Cleaved into：
GeneID：6373
Gene names (primary )：CXCL11
Gene names (synonym )：ITAC SCYB11 SCYB9B
Gene names (ORF )：
Length：94
Mass：10365
Sequence：MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Tissue specificity：High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders.
Induction：By IFNG/IFN-gamma and IFNB1/IFN-beta. Induction by IFNG/IFN-gamma is enhanced by TNF in monocytes, dermal fibroblasts and endothelial cells, and by IL1/interleukin-1 in astrocytes.
Developmental stage：
Protein families：Intercrine alpha (chemokine CxC) family