CAR17_HUMAN   Q5XLA6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5XLA6

Recommended name:Caspase recruitment domain-containing protein 17

EC number:

Alternative names:(Caspase-1 inhibitor INCA) (Inhibitory caspase recruitment domain protein)

Cleaved into:

GeneID:440068

Gene names  (primary ):CARD17

Gene names  (synonym ):INCA

Gene names  (ORF ):

Length:110

Mass:11868

Sequence:MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:15383541}.

Induction:By IFNG/IFN-gamma in monocytic cell lines. {ECO:0000269|PubMed:15383541}.

Developmental stage:

Protein families:


   💬 WhatsApp