SG1D4_HUMAN   Q6XE38


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6XE38

Recommended name:Secretoglobin family 1D member 4

EC number:

Alternative names:(IFN-gamma-inducible secretoglobin) (IIS)

Cleaved into:

GeneID:404552

Gene names  (primary ):SCGB1D4

Gene names  (synonym ):

Gene names  (ORF ):UNQ517/PRO812

Length:83

Mass:9201

Sequence:MRLSVCLLMVSLALCCYQAHALVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKLEVKHCTDQISFKKRLSLKKSWWK

Tissue specificity:Expressed in all tissues; the highest level of expression is detectable in lymph nodes, tonsil, cultured lymphoblasts and ovary. {ECO:0000269|PubMed:15034037}.

Induction:By IFNG/IFN-gamma. {ECO:0000269|PubMed:15034037}.

Developmental stage:

Protein families:Secretoglobin family, Lipophilin subfamily


   💬 WhatsApp