CXL10_HUMAN P02778
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02778
Recommended name：C-X-C motif chemokine 10
EC number：
Alternative names：(10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10)
Cleaved into：CXCL10(1-73)
GeneID：3627
Gene names (primary )：CXCL10
Gene names (synonym )：INP10 SCYB10
Gene names (ORF )：
Length：98
Mass：10881
Sequence：MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Tissue specificity：Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus (PubMed:11157474). Microglial cells produce CXCL10 in response to viral stimulation (PubMed:12663757). {ECO:0000269|PubMed:11157474, ECO:0000269|PubMed:12663757}.
Induction：By IFNG/IFN-gamma. A diverse population of cell types rapidly increases transcription of mRNA encoding this protein. This suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response.
Developmental stage：
Protein families：Intercrine alpha (chemokine CxC) family