INSI1_HUMAN O15503
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O15503
Recommended name:Insulin-induced gene 1 protein
EC number:
Alternative names:(INSIG-1)
Cleaved into:
GeneID:3638
Gene names (primary ):INSIG1
Gene names (synonym ):
Gene names (ORF ):
Length:277
Mass:29987
Sequence:MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
Tissue specificity:Expressed in all tissues tested with highest expression in the liver. {ECO:0000269|PubMed:12202038}.
Induction:By insulin (PubMed:9268630). Expressed at high levels when nuclear SREBP levels are high as a result of sterol deprivation (PubMed:16399501). {ECO:0000269|PubMed:16399501, ECO:0000269|PubMed:9268630}.
Developmental stage:
Protein families:INSIG family