ARL4C_HUMAN P56559
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56559
Recommended name：ADP-ribosylation factor-like protein 4C
EC number：
Alternative names：(ADP-ribosylation factor-like protein 7) (ADP-ribosylation factor-like protein LAK)
Cleaved into：
GeneID：10123
Gene names (primary )：ARL4C
Gene names (synonym )：ARL7
Gene names (ORF )：
Length：192
Mass：21487
Sequence：MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR
Tissue specificity：Expressed in several tumor cell lines (at protein level). Expressed in lung, brain, leukocytes and placenta. {ECO:0000269|PubMed:19409876}.
Induction：By liver X-receptor/retinoid X receptor agonists or cholesterol loading. {ECO:0000269|PubMed:15147902}.
Developmental stage：
Protein families：Small GTPase superfamily, Arf family