NAT8L_HUMAN Q8N9F0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N9F0
Recommended name：N-acetylaspartate synthetase
EC number：EC:2.3.1.17
Alternative names：(NAA synthetase) (Camello-like protein 3) (N-acetyltransferase 8-like protein)
Cleaved into：
GeneID：339983
Gene names (primary )：NAT8L
Gene names (synonym )：CML3
Gene names (ORF )：
Length：302
Mass：32837
Sequence：MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPVAQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCLVPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Tissue specificity：Expressed in brain. {ECO:0000269|PubMed:19807691}.
Induction：By methamphetamine in brain, via dopamine receptor activation (at protein level). {ECO:0000269|PubMed:20385109}.
Developmental stage：
Protein families：Camello family