PRAF3_HUMAN O75915
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75915
Recommended name：PRA1 family protein 3
EC number：
Alternative names：(ADP-ribosylation factor-like protein 6-interacting protein 5) (ARL-6-interacting protein 5) (Aip-5) (Cytoskeleton-related vitamin A-responsive protein) (Dermal papilla-derived protein 11) (GTRAP3-18) (Glutamate transporter EAAC1-interacting protein) (JM5) (Prenylated Rab acceptor protein 2) (Protein JWa) (Putative MAPK-activating protein PM27)
Cleaved into：
GeneID：10550
Gene names (primary )：ARL6IP5
Gene names (synonym )：DERP11 JWA PRA2 PRAF3
Gene names (ORF )：HSPC127
Length：188
Mass：21615
Sequence：MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Tissue specificity：
Induction：By methyl-beta-cyclodextrin (By similarity). Up-regulated upon induced differentiation and in heat stress. {ECO:0000250, ECO:0000269|PubMed:14761432}.
Developmental stage：
Protein families：PRA1 family