T53G3_HUMAN Q9ULZ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ULZ0
Recommended name：TP53-target gene 3 protein
EC number：
Alternative names：(TP53-inducible gene 3 protein)
Cleaved into：
GeneID：102723655
Gene names (primary )：TP53TG3; TP53TG3B; TP53TG3C; TP53TG3D; TP53TG3E; TP53TG3F
Gene names (synonym )：TP53TG3A; ; ; ; ;
Gene names (ORF )：; ; ; ; ;
Length：124
Mass：12828
Sequence：MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSSFSG
Tissue specificity：Strongly expressed in testis. Weakly expressed in heart, placenta and skeletal muscle. {ECO:0000269|PubMed:10534768}.
Induction：By p53/TP53. {ECO:0000269|PubMed:10534768}.
Developmental stage：
Protein families：