KLRG1_HUMAN Q96E93
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96E93
Recommended name：Killer cell lectin-like receptor subfamily G member 1
EC number：
Alternative names：(C-type lectin domain family 15 member A) (ITIM-containing receptor MAFA-L) (MAFA-like receptor) (Mast cell function-associated antigen)
Cleaved into：
GeneID：10219
Gene names (primary )：KLRG1
Gene names (synonym )：CLEC15A MAFA MAFAL
Gene names (ORF )：
Length：195
Mass：21831
Sequence：MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Tissue specificity：Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells. {ECO:0000269|PubMed:15879103, ECO:0000269|PubMed:9842918}.
Induction：By pathogens and viruses infections. {ECO:0000269|PubMed:15879103}.
Developmental stage：
Protein families：