ID3_HUMAN   Q02535


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q02535

Recommended name:DNA-binding protein inhibitor ID-3

EC number:

Alternative names:(Class B basic helix-loop-helix protein 25) (bHLHb25) (Helix-loop-helix protein HEIR-1) (ID-like protein inhibitor HLH 1R21) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3)

Cleaved into:

GeneID:3399

Gene names  (primary ):ID3

Gene names  (synonym ):1R21 BHLHB25 HEIR1

Gene names  (ORF ):

Length:119

Mass:12999

Sequence:MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

Tissue specificity:Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.

Induction:By phorbol 12-myristate 13-acetate (PMA).

Developmental stage:

Protein families:


   💬 WhatsApp