AREG_HUMAN   P15514


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15514

Recommended name:Amphiregulin

EC number:

Alternative names:(AR) (Colorectum cell-derived growth factor) (CRDGF)

Cleaved into:

GeneID:374

Gene names  (primary ):AREG

Gene names  (synonym ):AREGB SDGF

Gene names  (ORF ):

Length:252

Mass:27895

Sequence:MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA

Tissue specificity:

Induction:By phorbol 12-myristate 13-acetate (PMA).

Developmental stage:

Protein families:Amphiregulin family


   💬 WhatsApp