CCL17_HUMAN Q92583
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q92583
Recommended name：C-C motif chemokine 17
EC number：
Alternative names：(CC chemokine TARC) (Small-inducible cytokine A17) (Thymus and activation-regulated chemokine)
Cleaved into：
GeneID：6361
Gene names (primary )：CCL17
Gene names (synonym )：SCYA17 TARC
Gene names (ORF )：
Length：94
Mass：10507
Sequence：MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Tissue specificity：Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
Induction：By phytohemagglutinin (PHA) in the peripheral blood mononuclear cells and by cytokines in monocytes.
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family