PMF1_HUMAN Q6P1K2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P1K2
Recommended name：Polyamine-modulated factor 1
EC number：
Alternative names：(PMF-1)
Cleaved into：
GeneID：100527963
Gene names (primary )：PMF1
Gene names (synonym )：
Gene names (ORF )：
Length：205
Mass：23339
Sequence：MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE
Tissue specificity：Highest levels of expression in heart and skeletal muscle, with significant levels expressed in kidney and liver. {ECO:0000269|PubMed:10419538}.
Induction：By polyamine analogs in analog-sensitive H157 cells. {ECO:0000269|PubMed:10419538}.
Developmental stage：
Protein families：