IL36B_HUMAN Q9NZH7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NZH7
Recommended name：Interleukin-36 beta
EC number：
Alternative names：(FIL1 eta) (Interleukin-1 eta) (IL-1 eta) (Interleukin-1 family member 8) (IL-1F8) (Interleukin-1 homolog 2) (IL-1H2)
Cleaved into：
GeneID：27177
Gene names (primary )：IL36B
Gene names (synonym )：IL1F8 IL1H2
Gene names (ORF )：
Length：164
Mass：18522
Sequence：MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFMGTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Tissue specificity：Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin. Increased levels are not detected in inflamed joint tissue. {ECO:0000269|PubMed:20300079, ECO:0000269|PubMed:21242515}.
Induction：By proinflammatory cytokines IL1A, IL1B and TNF in synovial fibroblasts. By IL1A and TNF in keratinocytes. Constitutive in articular chondrocytes. {ECO:0000269|PubMed:16646978}.
Developmental stage：
Protein families：IL-1 family