LAPM5_HUMAN Q13571
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13571
Recommended name:Lysosomal-associated transmembrane protein 5
EC number:
Alternative names:(Lysosomal-associated multitransmembrane protein 5) (Retinoic acid-inducible E3 protein)
Cleaved into:
GeneID:7805
Gene names (primary ):LAPTM5
Gene names (synonym ):KIAA0085
Gene names (ORF ):
Length:262
Mass:29937
Sequence:MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV
Tissue specificity:Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. Highly expressed in peripheral blood leukocytes, thymus, spleen and lung, followed by placenta, liver and kidney. {ECO:0000269|PubMed:8661146}.
Induction:By retinoic acid.
Developmental stage:
Protein families:LAPTM4/LAPTM5 transporter family