PP4P1_HUMAN Q86T03
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86T03
Recommended name：Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase
EC number：EC:3.1.3.78
Alternative names：(Type 1 PtdIns-4,5-P2 4-Ptase) (PtdIns-4,5-P2 4-Ptase I) (Transmembrane protein 55B)
Cleaved into：
GeneID：90809
Gene names (primary )：PIP4P1
Gene names (synonym )：C14orf9 TMEM55B
Gene names (ORF )：
Length：277
Mass：29470
Sequence：MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:16365287}.
Induction：By sterol depletion. {ECO:0000269|PubMed:25035345, ECO:0000269|PubMed:29146937}.
Developmental stage：
Protein families：