PMVK_HUMAN   Q15126


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15126

Recommended name:Phosphomevalonate kinase

EC number:EC:2.7.4.2

Alternative names:(PMKase) (hPMK)

Cleaved into:

GeneID:10654

Gene names  (primary ):PMVK

Gene names  (synonym ):PMKI

Gene names  (ORF ):

Length:192

Mass:21995

Sequence:MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

Tissue specificity:Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. {ECO:0000269|PubMed:8663599}.

Induction:By sterol. {ECO:0000269|PubMed:10191291}.

Developmental stage:

Protein families:


   💬 WhatsApp