HCST_HUMAN Q9UBK5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UBK5
Recommended name：Hematopoietic cell signal transducer
EC number：
Alternative names：(DNAX-activation protein 10) (Membrane protein DAP10) (Transmembrane adapter protein KAP10)
Cleaved into：
GeneID：10870
Gene names (primary )：HCST
Gene names (synonym )：DAP10 KAP10 PIK3AP
Gene names (ORF )：UNQ587/PRO1157
Length：93
Mass：9489
Sequence：MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG
Tissue specificity：Predominantly expressed in hemopoietic cells such as NK cells, subset of T-cells and monocytes. Detected in leukocytes, spleen, and thymus. {ECO:0000269|PubMed:10528161}.
Induction：By T-cell receptor (TCR) ligation, which leads to enhanced KLRK1-HCST cell surface expression. Down-regulated by IL21/interleukin-21 in T-cells and NK cells. {ECO:0000269|PubMed:16424177, ECO:0000269|PubMed:18097042}.
Developmental stage：
Protein families：DAP10 family