YIPF5_HUMAN Q969M3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q969M3
Recommended name：Protein YIPF5
EC number：
Alternative names：(Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5) (Smooth muscle cell-associated protein 5) (SMAP-5) (YIP1 family member 5) (YPT-interacting protein 1 A)
Cleaved into：
GeneID：81555
Gene names (primary )：YIPF5
Gene names (synonym )：FINGER5 YIP1A
Gene names (ORF )：PP12723 SB140 UNQ3123/PRO10275
Length：257
Mass：27989
Sequence：MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLVAYPCALLYGVFALISVF
Tissue specificity：Ubiquitously expressed. Highly expressed in coronary smooth muscles. {ECO:0000269|PubMed:15922870}.
Induction：By TGFB1. {ECO:0000269|PubMed:15922870}.
Developmental stage：
Protein families：YIP1 family