EFNA1_HUMAN P20827
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20827
Recommended name：Ephrin-A1
EC number：
Alternative names：(EPH-related receptor tyrosine kinase ligand 1) (LERK-1) (Immediate early response protein B61) (Tumor necrosis factor alpha-induced protein 4) (TNF alpha-induced protein 4)
Cleaved into：Ephrin-A1, secreted form
GeneID：1942
Gene names (primary )：EFNA1
Gene names (synonym )：EPLG1 LERK1 TNFAIP4
Gene names (ORF )：
Length：205
Mass：23787
Sequence：MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP
Tissue specificity：Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level). {ECO:0000269|PubMed:17332925}.
Induction：By TNF and IL1B/interleukin-1 beta.
Developmental stage：
Protein families：Ephrin family