LEG9_HUMAN O00182
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O00182
Recommended name:Galectin-9
EC number:
Alternative names:(Gal-9) (Ecalectin) (Tumor antigen HOM-HD-21)
Cleaved into:
GeneID:3965
Gene names (primary ):LGALS9
Gene names (synonym ):
Gene names (ORF ):
Length:355
Mass:39518
Sequence:MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Tissue specificity:Peripheral blood leukocytes and lymphatic tissues. Expressed in lung, liver, breast and kidney with higher levels in tumor endothelial cells than normal endothelium (at protein level) (PubMed:24333696). Expressed in trophoblast cells in decidua and placenta in pregnancy (at protein level) (PubMed:23242525, PubMed:25578313). Isoform 2 is the most abundant isoform expressed in endothelial cells (PubMed:24333696). Upon endothelial cell activation isoform 2 expression decreases while expression of isoform 3 and isoform 5 increases (PubMed:24333696). Isoform 4 decreases in pathological pregnancy (PubMed:23242525). {ECO:0000269|PubMed:23242525, ECO:0000269|PubMed:24333696, ECO:0000269|PubMed:25578313}.
Induction:By toll-like receptor ligands zymosan (TLR2 ligand), polyinosinic:polycytidylic acid (poly I:C) (TLR3 ligand) and lipopolysaccharides (LPS) (TLR4 ligand) and by proinflammatory cytokines IFNG, TNFA, IL1A and IL1B in mesenchymal stromal cells (PubMed:23817958). By IFNG in macrophages (PubMed:20209097). Up-regulated in dendritic cells following infection with dengue virus (PubMed:25754930). Up-regulated in Kupffer cells following infection with hepatitis C virus (PubMed:20209097). Up-regulated in plasma following infection with HIV-1 (PubMed:24786365). {ECO:0000269|PubMed:20209097, ECO:0000269|PubMed:23817958, ECO:0000269|PubMed:24786365, ECO:0000269|PubMed:25754930}.
Developmental stage:
Protein families: