BATF2_HUMAN Q8N1L9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N1L9
Recommended name：Basic leucine zipper transcriptional factor ATF-like 2
EC number：
Alternative names：(B-ATF-2) (Suppressor of AP-1 regulated by IFN) (SARI)
Cleaved into：
GeneID：116071
Gene names (primary )：BATF2
Gene names (synonym )：
Gene names (ORF )：
Length：274
Mass：29398
Sequence：MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALRKEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Tissue specificity：
Induction：By type I interferon. Down-regulated in most hepatocellular carcinoma tumorous tissues (at protein level). {ECO:0000269|PubMed:19074269, ECO:0000269|PubMed:20473897}.
Developmental stage：
Protein families：BZIP family