IFNL1_HUMAN   Q8IU54


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IU54

Recommended name:Interferon lambda-1

EC number:

Alternative names:(IFN-lambda-1) (Cytokine Zcyto21) (Interleukin-29) (IL-29)

Cleaved into:

GeneID:282618

Gene names  (primary ):IFNL1

Gene names  (synonym ):IL29 ZCYTO21

Gene names  (ORF ):

Length:200

Mass:21898

Sequence:MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Tissue specificity:

Induction:By viral infections or double-stranded RNA.

Developmental stage:

Protein families:Lambda interferon family


   💬 WhatsApp