IFNL1_HUMAN Q8IU54
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IU54
Recommended name：Interferon lambda-1
EC number：
Alternative names：(IFN-lambda-1) (Cytokine Zcyto21) (Interleukin-29) (IL-29)
Cleaved into：
GeneID：282618
Gene names (primary )：IFNL1
Gene names (synonym )：IL29 ZCYTO21
Gene names (ORF )：
Length：200
Mass：21898
Sequence：MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Tissue specificity：
Induction：By viral infections or double-stranded RNA.
Developmental stage：
Protein families：Lambda interferon family