IFNL2_HUMAN Q8IZJ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IZJ0
Recommended name：Interferon lambda-2
EC number：
Alternative names：(IFN-lambda-2) (Cytokine Zcyto20) (Interleukin-28A) (IL-28A)
Cleaved into：
GeneID：282616
Gene names (primary )：IFNL2
Gene names (synonym )：IL28A ZCYTO20
Gene names (ORF )：
Length：200
Mass：22288
Sequence：MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Tissue specificity：
Induction：By viral infections or double-stranded RNA. {ECO:0000269|PubMed:12469119, ECO:0000269|PubMed:12483210}.
Developmental stage：
Protein families：Lambda interferon family