MAPK5_HUMAN   Q8IW41


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IW41

Recommended name:MAP kinase-activated protein kinase 5

EC number:EC:2.7.11.1

Alternative names:(MAPK-activated protein kinase 5) (MAPKAP kinase 5) (MAPKAP-K5) (MAPKAPK-5) (MK-5) (MK5) (p38-regulated/activated protein kinase) (PRAK)

Cleaved into:

GeneID:8550

Gene names  (primary ):MAPKAPK5

Gene names  (synonym ):PRAK

Gene names  (ORF ):

Length:473

Mass:54220

Sequence:MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ

Tissue specificity:Expressed ubiquitously. {ECO:0000269|PubMed:9628874}.

Induction:Directly regulated by MYC: expression is activated by MYC, suggesting the existence of a feedback regulatory loop. {ECO:0000269|PubMed:21329882}.

Developmental stage:

Protein families:Protein kinase superfamily, CAMK Ser/Thr protein kinase family


   💬 WhatsApp