RCN3_HUMAN Q96D15
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96D15
Recommended name：Reticulocalbin-3
EC number：
Alternative names：(EF-hand calcium-binding protein RLP49)
Cleaved into：
GeneID：57333
Gene names (primary )：RCN3
Gene names (synonym )：
Gene names (ORF )：UNQ239/PRO272
Length：328
Mass：37493
Sequence：MMWRPSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL
Tissue specificity：Widely expressed. {ECO:0000269|PubMed:16433634}.
Induction：Down-regulated by aldosterone (at protein level). No effect at the transcript level. {ECO:0000269|PubMed:28939891}.
Developmental stage：
Protein families：CREC family