BRF2_HUMAN   Q9HAW0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9HAW0

Recommended name:Transcription factor IIIB 50 kDa subunit

EC number:

Alternative names:(TFIIIB50) (hTFIIIB50) (B-related factor 2) (BRF-2) (hBRFU)

Cleaved into:

GeneID:55290

Gene names  (primary ):BRF2

Gene names  (synonym ):BRFU

Gene names  (ORF ):PRO1470

Length:419

Mass:46533

Sequence:MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

Tissue specificity:

Induction:Down-regulated by epigallocatechin gallate (EGCG) treatment. {ECO:0000269|PubMed:17624304}.

Developmental stage:

Protein families:TFIIB family


   💬 WhatsApp