LDOC1_HUMAN O95751
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95751
Recommended name:Protein LDOC1
EC number:
Alternative names:(Leucine zipper protein down-regulated in cancer cells)
Cleaved into:
GeneID:23641
Gene names (primary ):LDOC1
Gene names (synonym ):BCUR1
Gene names (ORF ):
Length:146
Mass:16968
Sequence:MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Tissue specificity:Ubiquitously expressed with high levels in brain ant thyroid and low expression in placenta, liver and leukocytes. Expressed as well in six of the seven human breast cancer cell lines examined. {ECO:0000269|PubMed:10403563}.
Induction:Down-regulated by muramyl-dipeptide and lipopolysaccharide. {ECO:0000269|PubMed:27812135}.
Developmental stage:
Protein families:LDOC1 family