ZFN2B_HUMAN   Q8WV99


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WV99

Recommended name:AN1-type zinc finger protein 2B

EC number:

Alternative names:(Arsenite-inducible RNA-associated protein-like protein) (AIRAP-like protein)

Cleaved into:

GeneID:130617

Gene names  (primary ):ZFAND2B

Gene names  (synonym ):AIRAPL

Gene names  (ORF ):

Length:257

Mass:28023

Sequence:MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC

Tissue specificity:

Induction:Down-regulated by the miRNA miR-125a-3p in myelo-proliferative neoplasms. {ECO:0000269|PubMed:26692333}.

Developmental stage:

Protein families:


   💬 WhatsApp