UB2V1_HUMAN Q13404
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13404
Recommended name：Ubiquitin-conjugating enzyme E2 variant 1
EC number：
Alternative names：(UEV-1) (CROC-1) (TRAF6-regulated IKK activator 1 beta Uev1A)
Cleaved into：
GeneID：387522
Gene names (primary )：UBE2V1
Gene names (synonym )：CROC1 UBE2V UEV1
Gene names (ORF )：P/OKcl.19
Length：147
Mass：16495
Sequence：MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
Tissue specificity：Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung. {ECO:0000269|PubMed:9418904, ECO:0000269|PubMed:9705497}.
Induction：Down-regulated during differentiation of cultured colon adenocarcinoma cells. {ECO:0000269|PubMed:9418904}.
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family